PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004509754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27997 Da    PI: 9.0466
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004509754.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.84.4e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++
  XP_004509754.1  9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.394161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.98E-43279No hitNo description
SuperFamilySSF554551.96E-34292IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.74988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIVFSH KGKLFEYATD  60
SCMEKILERY ERYSYAERQL VANDSESQGN WTIEYTRLKA KIDLLQRNYR HYMGEDLGSM  120
SLKELQSLEQ QLDTALKQIR TRRNQLMYES ISELQKKEKV IQEQNSMLAK KIKEKEKIAA  180
QQQAQWEHPN HGGVNPSFLL QQQLPSLNMG GNYREEAPEM GRNELDLTLE PLYTCHLGCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-21174173Myocyte-specific enhancer factor 2B
1tqe_R1e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q1e-21174173Myocyte-specific enhancer factor 2B
1tqe_P1e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4617400.0AF461740.1 Pisum sativum MADS-box transcription factor MADS4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004509754.11e-179PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotD7KWY61e-130AP1_ARALL; Floral homeotic protein APETALA 1
TrEMBLG7LGW91e-164G7LGW9_MEDTR; MADS-box transcription factor
STRINGGLYMA16G13070.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-108MIKC_MADS family protein